(Gly22)-Amyloid β-Protein (1-40)

CompanySerial Number：DC160031(31)

ProductName：(Gly22)-Amyloid β-Protein(1-40)

Synonym： Amyloidβ-Protein (1-40) Arctic Mutation, Amyloid β-Protein (1-40) E22G

CASNo.：[175010-18-1] net

Sequence(three-letter)：H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OHTrifluoroacetate salt

Sequence(one-letter)： DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV-OHTrifluoroacetatesalt

ConstitutionalFormula：

MolecularFormula： C191H291N53O56S

MolecularWeight：

References： A.P?ivi?et al., J. Mol. Biol., 339, 145 (2004)
B.M.Whalen et al., Neurobiol. Dis., 20, 254 (2005)
N.Yamamoto et al., J. Biol. Chem., 282, 2646 (2007)
A.R.Lam et al., J. Am. Chem. Soc., 130, 17413 (2008)
R.Solito et al., Exp. Cell Res., 315, 385 (2009)
A.Jan et al., Nat. Protoc., 5, 1186 (2010)

Illustration：Thehighly neurotoxic arctic mutant (E22G) of Aβ has been used to study themechanisms underlying the formation of soluble and insoluble β-amyloidaggregates. As the wild-type Aβ, the arctic mutant preferably assembles in thepresence of GM1 ganglioside.

ConditionOf Storage: -20± 5 °C